PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013596850.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 270aa    MW: 31316.5 Da    PI: 7.6779
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013596850.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding64.22.5e-202875148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd+llv++v+  G g+W+++a++ g++R++k+c++rw +yl
   XP_013596850.1 28 KGPWTPEEDKLLVEYVTSNGEGRWSSVAKCAGLNRSGKSCRLRWVNYL 75
                     79********************************************97 PP

2Myb_DNA-binding506.8e-1681125147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg  T++E+ ++++++ ++G++ W+tIar+++ gRt++++k++w+++
   XP_013596850.1  81 RGQITPQEEGIILELHSLWGNK-WSTIARYLP-GRTDNEIKNYWRTH 125
                      7888******************.*********.************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.062379IPR017930Myb domain
SuperFamilySSF466897.86E-3225122IPR009057Homeodomain-like
SMARTSM007171.6E-162777IPR001005SANT/Myb domain
PfamPF002491.8E-182875IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-242982IPR009057Homeodomain-like
CDDcd001674.03E-123075No hitNo description
SMARTSM007171.8E-1380128IPR001005SANT/Myb domain
PROSITE profilePS5129419.95280130IPR017930Myb domain
PfamPF002499.8E-1481125IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-2383129IPR009057Homeodomain-like
CDDcd001671.88E-985125No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MLDWGVDQVH HRNHDLYQQQ QQQQGCRKGP WTPEEDKLLV EYVTSNGEGR WSSVAKCAGL  60
NRSGKSCRLR WVNYLRPGLK RGQITPQEEG IILELHSLWG NKWSTIARYL PGRTDNEIKN  120
YWRTHYKKKE KSFSKQEKVK RSRKQLDLKP QPQQQPHQQN QSSHFVSEDH MNLDNEQNTF  180
SYQTGVFSDQ FHMPQVVAAT SSDHSMMDEG NLWGSLWSLD DHDPHHFGGF SEQRTAANVS  240
EKFNGCGIDA PFCGSWDYSY NGFNTGGYNY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25281297107B-MYB
1h8a_C3e-252812927127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3719801e-149AF371980.2 Arabidopsis thaliana putative transcription factor MYB121 (MYB121) mRNA, complete cds.
GenBankAY5195931e-149AY519593.1 Arabidopsis thaliana MYB transcription factor (At3g30210) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013705798.10.0PREDICTED: myb-related protein 305-like
RefseqXP_013596850.10.0PREDICTED: myb-related protein 305
TrEMBLA0A078D7Y80.0A0A078D7Y8_BRANA; BnaC07g25960D protein
TrEMBLA0A0D3DBL10.0A0A0D3DBL1_BRAOL; Uncharacterized protein
STRINGBra025410.1-P1e-173(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30210.11e-126myb domain protein 121